584063-Bourgonje

94 Supplementary Figure 2 | Peptide motif deconvolution map of A. DR15 and B. DQ8 and DR4 (amino acids code: negatively charged: red; positively charged: blue, polar uncharged: green, and hydrophobic: black) compared with the A. Lactococcus phage (YP_009222335.1 hypothetical protein LfeInf_097) and B. Human mastadenovirus minor core protein. Peptide cores and percentage of elution score (%Rank_EL: strong binding ≤ 2.0, weak binding 2.0–10.0, no binding > 10) predicted by NetMHCIIpan-4.050 are shown. Predicted binding mode, polar molecular interactions (dashes, hydrogen bonds: green, salt bridges: yellow), binding energy and dissociation constant (Kd) of the Streptococcus agalactiae C5a peptidase peptide core (red cartoon and sticks) into HLA-II receptors (chain A in green and chain B in blue). A B Lactococcus phage (YP_009222335.1 hypothetical protein LfeInf_097) PYMNNQGQPLFNTPLQFISAGQTFPVELKSTQGSDRHWSSTANALNQIALPPMS Human mastadenovirus minor core protein TMQLMVPKRQKLEDVLEHMKVDPSVQPDVKVRPIKKVAPGLGVQTVDIQIPVQTALGETMEIQT Chapter 3

RkJQdWJsaXNoZXIy MjY0ODMw